Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BL42

Protein Details
Accession I1BL42    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-62SPDSYRRKSRSPSRHEHRHSRSFERRDKYDRDIKKRKKRHYSSDDESSDBasic
NLS Segment(s)
PositionSequence
13-52RSPDSYRRKSRSPSRHEHRHSRSFERRDKYDRDIKKRKKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MADRKKESASRYRSPDSYRRKSRSPSRHEHRHSRSFERRDKYDRDIKKRKKRHYSSDDESSDSGSSSISSDSSEGVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.67
4 0.69
5 0.71
6 0.7
7 0.71
8 0.75
9 0.79
10 0.8
11 0.78
12 0.78
13 0.77
14 0.82
15 0.83
16 0.84
17 0.82
18 0.8
19 0.77
20 0.75
21 0.75
22 0.73
23 0.74
24 0.69
25 0.65
26 0.61
27 0.61
28 0.58
29 0.57
30 0.57
31 0.6
32 0.65
33 0.72
34 0.77
35 0.82
36 0.86
37 0.88
38 0.88
39 0.89
40 0.88
41 0.86
42 0.83
43 0.83
44 0.74
45 0.66
46 0.57
47 0.48
48 0.38
49 0.29
50 0.21
51 0.12
52 0.1
53 0.08
54 0.09
55 0.07
56 0.08
57 0.08