Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CRX3

Protein Details
Accession I1CRX3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-89ADVRRGRRDNRGPRAPRAQABasic
NLS Segment(s)
PositionSequence
75-83GRRDNRGPR
Subcellular Location(s) mito 18.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001210  Ribosomal_S17e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00833  Ribosomal_S17e  
Amino Acid Sequences MKRISRGPVRGISFKLQEEERERRDNYVPEFSALDTSAIEVDPETKELLKAINFENLPGVQVTNPIAAQADVRRGRRDNRGPRAPRAQAEASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.34
4 0.35
5 0.38
6 0.42
7 0.43
8 0.45
9 0.45
10 0.45
11 0.48
12 0.47
13 0.43
14 0.42
15 0.37
16 0.32
17 0.32
18 0.28
19 0.25
20 0.2
21 0.16
22 0.09
23 0.08
24 0.07
25 0.06
26 0.06
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.07
37 0.09
38 0.09
39 0.13
40 0.13
41 0.13
42 0.14
43 0.13
44 0.13
45 0.11
46 0.11
47 0.06
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.18
58 0.22
59 0.25
60 0.31
61 0.34
62 0.4
63 0.49
64 0.58
65 0.6
66 0.65
67 0.73
68 0.73
69 0.78
70 0.82
71 0.78
72 0.7
73 0.67