Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C3I7

Protein Details
Accession I1C3I7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67WNRLDAKIKEDKKKRPSTGQINSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 12.333, cyto 10, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MAKNSSFGESSKSTGMHAAFGTSAGDFGVVHVVHFKEFSIFFVSWNRLDAKIKEDKKKRPSTGQINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.16
5 0.14
6 0.12
7 0.12
8 0.11
9 0.07
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.11
27 0.11
28 0.12
29 0.16
30 0.19
31 0.17
32 0.19
33 0.2
34 0.18
35 0.22
36 0.22
37 0.24
38 0.31
39 0.39
40 0.47
41 0.54
42 0.62
43 0.69
44 0.79
45 0.8
46 0.81
47 0.83