Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CA96

Protein Details
Accession I1CA96    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKPIRQKERYIRWKDTPRHILKBasic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035927  DUSP-like_sf  
Amino Acid Sequences MKPIRQKERYIRWKDTPRHILKHGIYFIPSNWKNSWECFVEGWQTCPPGSIDLVNFIKLADASNHPVMISSVTWNYLSENYDVRGDKIAEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.79
5 0.77
6 0.72
7 0.7
8 0.63
9 0.62
10 0.54
11 0.45
12 0.38
13 0.33
14 0.31
15 0.32
16 0.3
17 0.27
18 0.25
19 0.28
20 0.27
21 0.28
22 0.31
23 0.22
24 0.23
25 0.19
26 0.19
27 0.21
28 0.2
29 0.21
30 0.19
31 0.17
32 0.16
33 0.16
34 0.15
35 0.1
36 0.11
37 0.09
38 0.08
39 0.13
40 0.13
41 0.13
42 0.13
43 0.12
44 0.11
45 0.1
46 0.11
47 0.08
48 0.1
49 0.14
50 0.15
51 0.15
52 0.14
53 0.15
54 0.14
55 0.14
56 0.12
57 0.1
58 0.1
59 0.11
60 0.12
61 0.12
62 0.13
63 0.14
64 0.15
65 0.15
66 0.16
67 0.16
68 0.21
69 0.22
70 0.22
71 0.24
72 0.23