Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C7A4

Protein Details
Accession I1C7A4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-47LSYSKTSRSTRWRREKEAKSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 7
Family & Domain DBs
Amino Acid Sequences MRNADPTISMSINNVLLDNNVKRNRPLSYSKTSRSTRWRREKEAKSVNDKGKLESFGFVSIAPVVEASSPILSKNELQLLRIQEMLPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.11
4 0.16
5 0.17
6 0.24
7 0.27
8 0.28
9 0.3
10 0.33
11 0.34
12 0.35
13 0.4
14 0.38
15 0.44
16 0.49
17 0.51
18 0.57
19 0.57
20 0.57
21 0.6
22 0.64
23 0.65
24 0.7
25 0.72
26 0.73
27 0.8
28 0.81
29 0.8
30 0.79
31 0.73
32 0.7
33 0.7
34 0.65
35 0.62
36 0.56
37 0.48
38 0.41
39 0.38
40 0.31
41 0.25
42 0.21
43 0.15
44 0.15
45 0.12
46 0.1
47 0.08
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.11
61 0.14
62 0.21
63 0.2
64 0.21
65 0.26
66 0.29
67 0.3
68 0.3
69 0.27