Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BJ78

Protein Details
Accession I1BJ78    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-108LTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGKBasic
NLS Segment(s)
PositionSequence
81-108RKRRLKMNKHKHKKLRKRTRALRKRLGK
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MIPKSLQWTVNIQRSVSTLPTSPNTHPVQLINYNIKETQSTATISEYVSRLRPFSAPPAPQPTTSPLTQVQEQFELTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.31
4 0.25
5 0.18
6 0.2
7 0.24
8 0.28
9 0.27
10 0.32
11 0.32
12 0.31
13 0.31
14 0.29
15 0.29
16 0.28
17 0.31
18 0.29
19 0.27
20 0.28
21 0.27
22 0.26
23 0.22
24 0.2
25 0.17
26 0.12
27 0.13
28 0.11
29 0.12
30 0.12
31 0.11
32 0.12
33 0.11
34 0.11
35 0.12
36 0.12
37 0.12
38 0.12
39 0.13
40 0.12
41 0.17
42 0.22
43 0.21
44 0.23
45 0.31
46 0.31
47 0.31
48 0.31
49 0.3
50 0.28
51 0.26
52 0.26
53 0.21
54 0.23
55 0.25
56 0.25
57 0.23
58 0.21
59 0.21
60 0.18
61 0.16
62 0.15
63 0.12
64 0.17
65 0.19
66 0.23
67 0.31
68 0.35
69 0.38
70 0.47
71 0.57
72 0.61
73 0.69
74 0.75
75 0.78
76 0.85
77 0.93
78 0.93
79 0.95
80 0.95
81 0.95
82 0.95
83 0.95
84 0.95
85 0.95
86 0.96
87 0.95
88 0.94