Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CW18

Protein Details
Accession I1CW18   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
121-148SKNFISCISQKKRRKWYRDKPSHTIEGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 14.333, nucl 10.5, cyto_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MTKYLPYMLKKISNCKRESLRFRIHLVRTAANLFRIARISKWTINRIRKEEKNIKACDHGSRQVVVSKITNAIIRLKFRQGPLRTVSDAQLFLRFLGYNISKLSVKRHCRKLDFESGTKESKNFISCISQKKRRKWYRDKPSHTIEGWKSIIFSNEKNMNAMSADSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.66
4 0.69
5 0.73
6 0.72
7 0.72
8 0.67
9 0.71
10 0.72
11 0.65
12 0.62
13 0.57
14 0.5
15 0.43
16 0.42
17 0.38
18 0.3
19 0.3
20 0.24
21 0.22
22 0.22
23 0.21
24 0.18
25 0.21
26 0.25
27 0.28
28 0.33
29 0.4
30 0.46
31 0.54
32 0.6
33 0.63
34 0.67
35 0.67
36 0.72
37 0.73
38 0.72
39 0.72
40 0.67
41 0.62
42 0.58
43 0.55
44 0.5
45 0.46
46 0.41
47 0.34
48 0.32
49 0.3
50 0.28
51 0.27
52 0.23
53 0.19
54 0.15
55 0.14
56 0.14
57 0.14
58 0.12
59 0.17
60 0.18
61 0.2
62 0.21
63 0.23
64 0.25
65 0.26
66 0.34
67 0.3
68 0.32
69 0.32
70 0.34
71 0.32
72 0.3
73 0.29
74 0.22
75 0.21
76 0.17
77 0.16
78 0.12
79 0.11
80 0.11
81 0.09
82 0.08
83 0.11
84 0.11
85 0.11
86 0.11
87 0.13
88 0.14
89 0.14
90 0.21
91 0.26
92 0.35
93 0.43
94 0.52
95 0.57
96 0.6
97 0.66
98 0.66
99 0.68
100 0.64
101 0.58
102 0.56
103 0.52
104 0.5
105 0.45
106 0.38
107 0.29
108 0.27
109 0.26
110 0.2
111 0.18
112 0.23
113 0.28
114 0.38
115 0.45
116 0.52
117 0.59
118 0.68
119 0.77
120 0.8
121 0.86
122 0.87
123 0.89
124 0.9
125 0.93
126 0.92
127 0.88
128 0.85
129 0.81
130 0.71
131 0.69
132 0.6
133 0.56
134 0.49
135 0.41
136 0.35
137 0.29
138 0.33
139 0.27
140 0.26
141 0.28
142 0.32
143 0.33
144 0.33
145 0.32
146 0.28
147 0.26
148 0.25