Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BJI0

Protein Details
Accession I1BJI0   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-115KAKALEEKKKLKEKAKKAFIRQSKDNSHydrophilic
NLS Segment(s)
PositionSequence
91-109KALEEKKKLKEKAKKAFIR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015033  HBS1-like_N  
Pfam View protein in Pfam  
PF08938  HBS1_N  
Amino Acid Sequences MSRHRAVRNLDVDGILEEDYYQSESENDFDESELTNEDLDLLDEGLEYIESVIGENNGILSSRQIKEALWYYYLNKEETLEWALDEISKAKALEEKKKLKEKAKKAFIRQSKDNSPPRNSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.16
3 0.12
4 0.08
5 0.07
6 0.08
7 0.08
8 0.07
9 0.06
10 0.07
11 0.08
12 0.09
13 0.11
14 0.11
15 0.1
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.09
22 0.08
23 0.07
24 0.07
25 0.06
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.03
47 0.04
48 0.09
49 0.09
50 0.11
51 0.11
52 0.11
53 0.14
54 0.17
55 0.17
56 0.15
57 0.16
58 0.16
59 0.21
60 0.23
61 0.2
62 0.17
63 0.17
64 0.15
65 0.17
66 0.16
67 0.12
68 0.1
69 0.1
70 0.1
71 0.09
72 0.09
73 0.08
74 0.07
75 0.08
76 0.08
77 0.08
78 0.13
79 0.19
80 0.28
81 0.36
82 0.45
83 0.52
84 0.61
85 0.68
86 0.74
87 0.79
88 0.8
89 0.81
90 0.83
91 0.83
92 0.83
93 0.86
94 0.85
95 0.83
96 0.81
97 0.79
98 0.77
99 0.78
100 0.78
101 0.76
102 0.74