Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S8P4

Protein Details
Accession E3S8P4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
131-153MDNQKLKKRVKGLKKYVKTSEKSHydrophilic
NLS Segment(s)
PositionSequence
137-144KKRVKGLK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG pte:PTT_19365  -  
Amino Acid Sequences MLSSSKNTLDKPPSKAQARSRAPNPADSPQHAPTIQDNNVLKVNDLDAFILAYKKLQSDNANLQVQVADQAATINQTQGFFDDAERALDELKAKDKEIERLRKKKIIVQEHNEDSMSKSVKSGLSYAKLTMDNQKLKKRVKGLKKYVKTSEKSLEEYKKSLKEYMESLDKYTKSLEEYKKSLDEYKTRVKTLVDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.71
4 0.72
5 0.74
6 0.75
7 0.71
8 0.72
9 0.67
10 0.67
11 0.63
12 0.6
13 0.57
14 0.52
15 0.53
16 0.46
17 0.48
18 0.4
19 0.37
20 0.34
21 0.36
22 0.33
23 0.35
24 0.33
25 0.31
26 0.35
27 0.33
28 0.28
29 0.22
30 0.22
31 0.15
32 0.15
33 0.13
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.07
40 0.08
41 0.09
42 0.1
43 0.14
44 0.16
45 0.21
46 0.28
47 0.34
48 0.34
49 0.33
50 0.32
51 0.28
52 0.25
53 0.2
54 0.14
55 0.07
56 0.05
57 0.06
58 0.05
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.09
67 0.08
68 0.08
69 0.09
70 0.08
71 0.09
72 0.09
73 0.08
74 0.07
75 0.08
76 0.09
77 0.08
78 0.13
79 0.13
80 0.13
81 0.17
82 0.17
83 0.25
84 0.32
85 0.41
86 0.46
87 0.53
88 0.58
89 0.59
90 0.59
91 0.55
92 0.56
93 0.56
94 0.55
95 0.53
96 0.55
97 0.52
98 0.52
99 0.48
100 0.4
101 0.3
102 0.26
103 0.21
104 0.14
105 0.12
106 0.13
107 0.14
108 0.15
109 0.16
110 0.16
111 0.18
112 0.19
113 0.19
114 0.19
115 0.19
116 0.19
117 0.25
118 0.29
119 0.33
120 0.38
121 0.45
122 0.5
123 0.54
124 0.59
125 0.6
126 0.62
127 0.66
128 0.71
129 0.75
130 0.78
131 0.81
132 0.82
133 0.82
134 0.82
135 0.75
136 0.7
137 0.67
138 0.6
139 0.58
140 0.58
141 0.57
142 0.51
143 0.52
144 0.52
145 0.49
146 0.48
147 0.47
148 0.4
149 0.35
150 0.34
151 0.36
152 0.38
153 0.34
154 0.35
155 0.38
156 0.36
157 0.34
158 0.33
159 0.29
160 0.25
161 0.33
162 0.38
163 0.38
164 0.42
165 0.46
166 0.48
167 0.49
168 0.51
169 0.49
170 0.48
171 0.48
172 0.56
173 0.56
174 0.54
175 0.54
176 0.51