Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CD74

Protein Details
Accession I1CD74    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-94AEKSYHFIKRKRQCFRMKGILLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
Pfam View protein in Pfam  
PF08313  SCA7  
Amino Acid Sequences MGAKRSVKGRSQPYDFLLAAYQKKTIGRPNVQEQPTNIYKVKLMNEENNLIDSDDELDTVMEGVQYIQPTPLAEKSYHFIKRKRQCFRMKGILLDAITPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.5
3 0.43
4 0.36
5 0.32
6 0.29
7 0.26
8 0.24
9 0.2
10 0.22
11 0.25
12 0.29
13 0.33
14 0.37
15 0.42
16 0.48
17 0.55
18 0.55
19 0.54
20 0.47
21 0.45
22 0.41
23 0.39
24 0.32
25 0.24
26 0.23
27 0.24
28 0.25
29 0.24
30 0.24
31 0.24
32 0.26
33 0.27
34 0.26
35 0.24
36 0.21
37 0.16
38 0.13
39 0.09
40 0.08
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.03
49 0.03
50 0.03
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.09
58 0.11
59 0.12
60 0.13
61 0.14
62 0.17
63 0.24
64 0.32
65 0.37
66 0.4
67 0.49
68 0.59
69 0.67
70 0.74
71 0.76
72 0.78
73 0.8
74 0.84
75 0.84
76 0.77
77 0.7
78 0.64
79 0.59
80 0.49
81 0.44