Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CHU6

Protein Details
Accession I1CHU6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-72LQEHERKENKKNFKKGWFENQKARTRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MCHFKKKAQRFAYSLEEAPKTQYLLSGRLLQKSGQLVEITNQGQALQEHERKENKKNFKKGWFENQKARTRSLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.42
4 0.35
5 0.34
6 0.29
7 0.22
8 0.18
9 0.19
10 0.17
11 0.17
12 0.19
13 0.24
14 0.24
15 0.26
16 0.27
17 0.23
18 0.24
19 0.23
20 0.21
21 0.14
22 0.13
23 0.11
24 0.11
25 0.15
26 0.12
27 0.11
28 0.1
29 0.09
30 0.09
31 0.09
32 0.12
33 0.14
34 0.18
35 0.2
36 0.25
37 0.33
38 0.35
39 0.45
40 0.51
41 0.56
42 0.63
43 0.71
44 0.74
45 0.76
46 0.82
47 0.81
48 0.83
49 0.83
50 0.8
51 0.8
52 0.81
53 0.81
54 0.75