Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BYF1

Protein Details
Accession I1BYF1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-55KSMIRRISRKTKMQSKNSAGRHRHydrophilic
NLS Segment(s)
PositionSequence
96-112ITRTFKRKGLKSAKKKT
Subcellular Location(s) nucl 11.5, mito_nucl 9.5, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTAKNADKHVQIENMLNHSIPWNIIQKKVGCGKSMIRRISRKTKMQSKNSAGRHRLLTPREETKAARDIILGLSKSAADASFGVKKPDRSVNPKTITRTFKRKGLKSAKKKTALPLSNDRQKARYDWAKAHKDWSETDWERVVFSDETKIQKRGPNGLGYAWKEDNAPYRDHHYKKKHAYGAGGIML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.29
4 0.25
5 0.23
6 0.21
7 0.16
8 0.16
9 0.21
10 0.23
11 0.26
12 0.31
13 0.31
14 0.37
15 0.45
16 0.43
17 0.36
18 0.37
19 0.42
20 0.47
21 0.53
22 0.53
23 0.53
24 0.58
25 0.64
26 0.71
27 0.72
28 0.71
29 0.72
30 0.76
31 0.78
32 0.8
33 0.82
34 0.8
35 0.8
36 0.8
37 0.8
38 0.72
39 0.66
40 0.61
41 0.56
42 0.55
43 0.48
44 0.44
45 0.4
46 0.42
47 0.41
48 0.4
49 0.35
50 0.33
51 0.36
52 0.31
53 0.26
54 0.21
55 0.19
56 0.18
57 0.21
58 0.16
59 0.1
60 0.1
61 0.1
62 0.09
63 0.09
64 0.07
65 0.05
66 0.05
67 0.07
68 0.13
69 0.13
70 0.16
71 0.18
72 0.19
73 0.21
74 0.28
75 0.3
76 0.32
77 0.38
78 0.44
79 0.47
80 0.5
81 0.51
82 0.51
83 0.53
84 0.5
85 0.54
86 0.48
87 0.5
88 0.55
89 0.54
90 0.57
91 0.62
92 0.68
93 0.69
94 0.77
95 0.78
96 0.76
97 0.74
98 0.71
99 0.7
100 0.64
101 0.59
102 0.58
103 0.57
104 0.59
105 0.61
106 0.55
107 0.47
108 0.45
109 0.41
110 0.4
111 0.39
112 0.36
113 0.4
114 0.48
115 0.53
116 0.52
117 0.55
118 0.5
119 0.45
120 0.42
121 0.37
122 0.37
123 0.32
124 0.34
125 0.31
126 0.28
127 0.26
128 0.25
129 0.26
130 0.17
131 0.16
132 0.18
133 0.19
134 0.26
135 0.29
136 0.32
137 0.32
138 0.36
139 0.39
140 0.42
141 0.42
142 0.4
143 0.37
144 0.38
145 0.42
146 0.4
147 0.42
148 0.34
149 0.31
150 0.27
151 0.29
152 0.34
153 0.29
154 0.29
155 0.26
156 0.34
157 0.43
158 0.48
159 0.56
160 0.57
161 0.65
162 0.73
163 0.8
164 0.79
165 0.73
166 0.72
167 0.67