Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RW82

Protein Details
Accession E3RW82    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-99LAPLLRRQQRRERRGYKPPQVWWGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
KEGG pte:PTT_13499  -  
Amino Acid Sequences MLHFRRIRVNLIVTDITAAAVRMCLRRVVRLLKERVLSLQEVKIGYSHMNASAAVRDHGFALLFKRKDIAESMCELAPLLRRQQRRERRGYKPPQVWWGVIEAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.17
4 0.13
5 0.11
6 0.06
7 0.07
8 0.09
9 0.09
10 0.1
11 0.15
12 0.16
13 0.2
14 0.24
15 0.31
16 0.37
17 0.44
18 0.47
19 0.47
20 0.47
21 0.44
22 0.41
23 0.36
24 0.3
25 0.23
26 0.2
27 0.17
28 0.16
29 0.16
30 0.14
31 0.12
32 0.11
33 0.1
34 0.09
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.1
49 0.16
50 0.17
51 0.16
52 0.18
53 0.17
54 0.19
55 0.21
56 0.2
57 0.16
58 0.18
59 0.2
60 0.18
61 0.18
62 0.17
63 0.15
64 0.17
65 0.17
66 0.22
67 0.27
68 0.32
69 0.4
70 0.51
71 0.6
72 0.65
73 0.74
74 0.75
75 0.78
76 0.84
77 0.87
78 0.87
79 0.85
80 0.81
81 0.79
82 0.74
83 0.65
84 0.56