Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CHZ6

Protein Details
Accession I1CHZ6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-47VENQPIKKKRSKKVTRSEQAVQHydrophilic
NLS Segment(s)
PositionSequence
32-38KKKRSKK
Subcellular Location(s) nucl 20, cyto_nucl 14.833, mito_nucl 10.999, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSLSEAQQQPIKQKETTEIVTDEQVVENQPIKKKRSKKVTRSEQAVQQQQQGFVQQPDNNRSKAPRLRLDLNLDAEIHLKAKVHGDITLTLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.4
4 0.36
5 0.31
6 0.28
7 0.28
8 0.26
9 0.21
10 0.16
11 0.14
12 0.11
13 0.11
14 0.14
15 0.17
16 0.23
17 0.28
18 0.32
19 0.4
20 0.48
21 0.55
22 0.63
23 0.69
24 0.73
25 0.79
26 0.85
27 0.84
28 0.81
29 0.76
30 0.71
31 0.68
32 0.63
33 0.53
34 0.47
35 0.4
36 0.34
37 0.31
38 0.26
39 0.2
40 0.15
41 0.18
42 0.15
43 0.19
44 0.25
45 0.28
46 0.27
47 0.28
48 0.29
49 0.34
50 0.38
51 0.42
52 0.43
53 0.46
54 0.5
55 0.53
56 0.57
57 0.54
58 0.5
59 0.44
60 0.37
61 0.31
62 0.27
63 0.23
64 0.17
65 0.13
66 0.1
67 0.1
68 0.14
69 0.16
70 0.16
71 0.16
72 0.18
73 0.19