Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BU37

Protein Details
Accession I1BU37    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-61EIETKFRKFRKLRNNLKKDKVIAHydrophilic
NLS Segment(s)
PositionSequence
47-49FRK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MGVSVLKQNYDTKKKVGSGGGKSRLIKADEFQYRSNQKEIETKFRKFRKLRNNLKKDKVIAAEFSLSHFKSSLVNKDRFVEYLQEPKSLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.5
4 0.48
5 0.49
6 0.55
7 0.58
8 0.57
9 0.55
10 0.54
11 0.51
12 0.45
13 0.37
14 0.29
15 0.31
16 0.32
17 0.35
18 0.33
19 0.37
20 0.39
21 0.4
22 0.4
23 0.33
24 0.28
25 0.32
26 0.34
27 0.37
28 0.39
29 0.41
30 0.47
31 0.51
32 0.58
33 0.55
34 0.61
35 0.61
36 0.66
37 0.74
38 0.76
39 0.82
40 0.81
41 0.84
42 0.8
43 0.72
44 0.66
45 0.58
46 0.49
47 0.4
48 0.33
49 0.27
50 0.22
51 0.22
52 0.22
53 0.18
54 0.17
55 0.16
56 0.15
57 0.18
58 0.22
59 0.3
60 0.33
61 0.37
62 0.38
63 0.42
64 0.43
65 0.39
66 0.37
67 0.32
68 0.29
69 0.35
70 0.34
71 0.34