Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CSB7

Protein Details
Accession I1CSB7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-94LKDLKEKREREKEDYYKRRKNGKGIMBasic
NLS Segment(s)
PositionSequence
75-80KREREK
85-89KRRKN
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MSEFARNLHTNVISSEEFEFIENFKNFEVTIPITLPVWLWGGEVKFRKHSSLRLKFLNSEMMTEEERELKDLKEKREREKEDYYKRRKNGKGIMAQYTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.16
5 0.15
6 0.15
7 0.11
8 0.18
9 0.16
10 0.16
11 0.15
12 0.15
13 0.14
14 0.15
15 0.17
16 0.11
17 0.12
18 0.12
19 0.12
20 0.12
21 0.12
22 0.11
23 0.09
24 0.08
25 0.07
26 0.06
27 0.07
28 0.08
29 0.12
30 0.16
31 0.16
32 0.2
33 0.21
34 0.24
35 0.25
36 0.32
37 0.39
38 0.44
39 0.47
40 0.47
41 0.47
42 0.45
43 0.45
44 0.44
45 0.33
46 0.25
47 0.22
48 0.2
49 0.19
50 0.18
51 0.18
52 0.13
53 0.13
54 0.14
55 0.14
56 0.12
57 0.2
58 0.24
59 0.32
60 0.39
61 0.44
62 0.53
63 0.62
64 0.68
65 0.67
66 0.73
67 0.75
68 0.76
69 0.82
70 0.83
71 0.82
72 0.83
73 0.86
74 0.82
75 0.81
76 0.79
77 0.78
78 0.77
79 0.74
80 0.76