Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BU29

Protein Details
Accession I1BU29   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-100DTGAKKEQKQTKKTPGSKRSASHydrophilic
NLS Segment(s)
PositionSequence
81-94GAKKEQKQTKKTPG
237-245KSQGRRRGK
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MSFTNKLKEGWLATPPPTCPPKSKARYSSVWNRSKSRLKASSYVDILSDRQDWLDGYSQSDPNLNDKHSIQRKTKSLRDTGAKKEQKQTKKTPGSKRSASLGYYQKNESRSSNSLSDYQGYSRQSSVTSSSGRSFTYSPPPPCISQSPSPSSIPPVPPMPKQLRVSSLSQVGGKSSRSTSDYMASFSQDLAEIESDIRILEIQRERHSQFMAQQKEEIKRMQKEYEESLVQKESTKKSQGRRRGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.39
4 0.41
5 0.4
6 0.4
7 0.42
8 0.5
9 0.54
10 0.63
11 0.63
12 0.65
13 0.67
14 0.7
15 0.75
16 0.74
17 0.74
18 0.7
19 0.67
20 0.69
21 0.72
22 0.7
23 0.69
24 0.66
25 0.63
26 0.65
27 0.65
28 0.64
29 0.57
30 0.51
31 0.42
32 0.36
33 0.31
34 0.26
35 0.22
36 0.14
37 0.13
38 0.13
39 0.12
40 0.13
41 0.17
42 0.14
43 0.17
44 0.2
45 0.2
46 0.2
47 0.23
48 0.22
49 0.23
50 0.25
51 0.23
52 0.22
53 0.23
54 0.32
55 0.37
56 0.43
57 0.44
58 0.48
59 0.56
60 0.6
61 0.65
62 0.61
63 0.58
64 0.57
65 0.6
66 0.58
67 0.58
68 0.62
69 0.62
70 0.59
71 0.63
72 0.66
73 0.67
74 0.69
75 0.7
76 0.7
77 0.74
78 0.79
79 0.81
80 0.81
81 0.8
82 0.75
83 0.68
84 0.62
85 0.54
86 0.46
87 0.42
88 0.4
89 0.36
90 0.35
91 0.35
92 0.33
93 0.33
94 0.33
95 0.28
96 0.27
97 0.26
98 0.27
99 0.27
100 0.26
101 0.26
102 0.25
103 0.24
104 0.19
105 0.18
106 0.18
107 0.17
108 0.16
109 0.14
110 0.14
111 0.13
112 0.13
113 0.15
114 0.13
115 0.13
116 0.14
117 0.15
118 0.16
119 0.16
120 0.17
121 0.15
122 0.15
123 0.22
124 0.28
125 0.28
126 0.31
127 0.33
128 0.32
129 0.34
130 0.35
131 0.32
132 0.31
133 0.35
134 0.34
135 0.35
136 0.35
137 0.33
138 0.33
139 0.32
140 0.27
141 0.24
142 0.26
143 0.26
144 0.27
145 0.34
146 0.35
147 0.38
148 0.4
149 0.4
150 0.39
151 0.39
152 0.41
153 0.36
154 0.35
155 0.29
156 0.27
157 0.24
158 0.21
159 0.2
160 0.18
161 0.17
162 0.14
163 0.15
164 0.16
165 0.18
166 0.18
167 0.21
168 0.21
169 0.22
170 0.21
171 0.2
172 0.18
173 0.16
174 0.15
175 0.11
176 0.1
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.07
184 0.07
185 0.06
186 0.06
187 0.12
188 0.18
189 0.22
190 0.27
191 0.33
192 0.35
193 0.37
194 0.39
195 0.35
196 0.36
197 0.41
198 0.43
199 0.38
200 0.41
201 0.44
202 0.48
203 0.49
204 0.49
205 0.48
206 0.48
207 0.52
208 0.54
209 0.53
210 0.52
211 0.53
212 0.53
213 0.49
214 0.43
215 0.42
216 0.39
217 0.34
218 0.35
219 0.37
220 0.37
221 0.4
222 0.48
223 0.51
224 0.59
225 0.68
226 0.74