Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CRE1

Protein Details
Accession I1CRE1   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-97LTLRKQKPVQKKAVGSKKRKNAEHydrophilic
NLS Segment(s)
PositionSequence
78-94RKQKPVQKKAVGSKKRK
Subcellular Location(s) cyto 12, nucl 11.5, mito_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MDEIPESELTEIETVQDDLYDTVDPEWHYWGQPEISKKVTESVVKKLVDLSNYEGFRQDVFMRVGAICKKGLIGLTLRKQKPVQKKAVGSKKRKNAEVVECYGYLGSTWDEEPLPGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.09
7 0.08
8 0.07
9 0.07
10 0.1
11 0.1
12 0.11
13 0.14
14 0.13
15 0.13
16 0.14
17 0.16
18 0.16
19 0.19
20 0.22
21 0.22
22 0.23
23 0.23
24 0.23
25 0.24
26 0.25
27 0.27
28 0.26
29 0.29
30 0.33
31 0.33
32 0.32
33 0.33
34 0.31
35 0.26
36 0.25
37 0.23
38 0.22
39 0.22
40 0.22
41 0.2
42 0.19
43 0.17
44 0.17
45 0.13
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.13
52 0.12
53 0.14
54 0.11
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.11
61 0.16
62 0.24
63 0.33
64 0.33
65 0.37
66 0.4
67 0.47
68 0.54
69 0.57
70 0.59
71 0.57
72 0.65
73 0.71
74 0.78
75 0.81
76 0.8
77 0.8
78 0.8
79 0.8
80 0.76
81 0.71
82 0.68
83 0.68
84 0.65
85 0.6
86 0.54
87 0.47
88 0.44
89 0.38
90 0.29
91 0.2
92 0.14
93 0.1
94 0.09
95 0.09
96 0.1
97 0.11
98 0.11