Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CPM3

Protein Details
Accession I1CPM3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MRKPGNVKKRKVHGATKRKASRDRLSBasic
NLS Segment(s)
PositionSequence
3-24KPGNVKKRKVHGATKRKASRDR
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MRKPGNVKKRKVHGATKRKASRDRLSVPKGTTGAHCMHFIIDTLDIMDNFPAMKGFHIIMDNVPIHVPEVVDPLIIKRGYVPIYLPPYSLELNPIEQFWSVVKSKVRRHTLEDTETLITKIVEACEAVPLEHLQNIIGHLFKLFKKCSNKQSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.87
4 0.85
5 0.83
6 0.83
7 0.81
8 0.79
9 0.77
10 0.76
11 0.75
12 0.73
13 0.71
14 0.64
15 0.6
16 0.52
17 0.44
18 0.37
19 0.31
20 0.28
21 0.24
22 0.23
23 0.18
24 0.18
25 0.16
26 0.15
27 0.13
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.07
43 0.08
44 0.09
45 0.09
46 0.08
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.08
55 0.05
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.1
62 0.1
63 0.09
64 0.07
65 0.1
66 0.11
67 0.11
68 0.12
69 0.13
70 0.17
71 0.18
72 0.18
73 0.16
74 0.17
75 0.18
76 0.17
77 0.15
78 0.11
79 0.13
80 0.13
81 0.13
82 0.11
83 0.1
84 0.11
85 0.09
86 0.12
87 0.11
88 0.14
89 0.19
90 0.25
91 0.33
92 0.41
93 0.48
94 0.47
95 0.53
96 0.58
97 0.6
98 0.57
99 0.52
100 0.46
101 0.4
102 0.38
103 0.31
104 0.23
105 0.16
106 0.12
107 0.12
108 0.09
109 0.08
110 0.08
111 0.08
112 0.1
113 0.11
114 0.1
115 0.1
116 0.11
117 0.12
118 0.12
119 0.12
120 0.1
121 0.1
122 0.11
123 0.12
124 0.11
125 0.1
126 0.1
127 0.14
128 0.16
129 0.23
130 0.26
131 0.32
132 0.42
133 0.5