Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S9P2

Protein Details
Accession E3S9P2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LGKSWYKKERIKQITKEAGWHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 26
Family & Domain DBs
KEGG pte:PTT_19778  -  
Amino Acid Sequences MSFSSSGEKVFSLFDDVGAASHILRTLKPGRTGIIVVWEDMPWHVALENVHHKIRRADEPMAPFLGKSWYKKERIKQITKEAGWKDINFIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.11
6 0.11
7 0.06
8 0.06
9 0.08
10 0.08
11 0.08
12 0.13
13 0.18
14 0.22
15 0.26
16 0.26
17 0.26
18 0.27
19 0.28
20 0.22
21 0.23
22 0.19
23 0.16
24 0.16
25 0.14
26 0.13
27 0.12
28 0.13
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.09
35 0.15
36 0.17
37 0.19
38 0.2
39 0.21
40 0.24
41 0.28
42 0.29
43 0.29
44 0.29
45 0.32
46 0.35
47 0.36
48 0.34
49 0.3
50 0.24
51 0.2
52 0.23
53 0.22
54 0.22
55 0.28
56 0.34
57 0.41
58 0.49
59 0.56
60 0.61
61 0.68
62 0.75
63 0.75
64 0.78
65 0.8
66 0.76
67 0.76
68 0.67
69 0.64
70 0.59
71 0.51