Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C7X2

Protein Details
Accession I1C7X2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-95DVLRAKNKALRERRANKKAEKVEAHydrophilic
NLS Segment(s)
PositionSequence
56-65KAKAEKVRAK
74-92LRAKNKALRERRANKKAEK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences MSSQVIWMRRMRVLRRLLAKYREAGKIDKHLYHQLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKAEKVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.61
4 0.63
5 0.62
6 0.6
7 0.57
8 0.55
9 0.53
10 0.47
11 0.43
12 0.39
13 0.41
14 0.42
15 0.39
16 0.38
17 0.39
18 0.38
19 0.38
20 0.38
21 0.35
22 0.37
23 0.39
24 0.39
25 0.34
26 0.35
27 0.38
28 0.41
29 0.46
30 0.46
31 0.5
32 0.54
33 0.54
34 0.53
35 0.49
36 0.45
37 0.42
38 0.43
39 0.42
40 0.38
41 0.37
42 0.36
43 0.35
44 0.37
45 0.37
46 0.37
47 0.37
48 0.38
49 0.44
50 0.47
51 0.48
52 0.47
53 0.48
54 0.44
55 0.38
56 0.35
57 0.27
58 0.32
59 0.3
60 0.26
61 0.23
62 0.2
63 0.21
64 0.24
65 0.3
66 0.33
67 0.42
68 0.51
69 0.58
70 0.68
71 0.77
72 0.82
73 0.84
74 0.83
75 0.84