Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BP58

Protein Details
Accession I1BP58    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
63-90YPHSISRQSKKARRDKQHRHSTPNVPVAHydrophilic
NLS Segment(s)
PositionSequence
72-78KKARRDK
Subcellular Location(s) nucl 20, mito_nucl 12.999, cyto_nucl 12.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MGQKYVPPKTAKITNSPSSSKVLKTNPSGTISTMMKSVSLDDDNSNLADVAAHSTNPNSKRSYPHSISRQSKKARRDKQHRHSTPNVPVAATRTSKRLRNSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.56
4 0.51
5 0.48
6 0.47
7 0.41
8 0.4
9 0.38
10 0.38
11 0.41
12 0.43
13 0.42
14 0.43
15 0.41
16 0.35
17 0.35
18 0.29
19 0.24
20 0.2
21 0.17
22 0.13
23 0.12
24 0.12
25 0.09
26 0.1
27 0.1
28 0.1
29 0.11
30 0.11
31 0.11
32 0.1
33 0.07
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.12
43 0.14
44 0.16
45 0.17
46 0.19
47 0.25
48 0.31
49 0.4
50 0.39
51 0.46
52 0.51
53 0.58
54 0.65
55 0.67
56 0.69
57 0.7
58 0.72
59 0.74
60 0.77
61 0.77
62 0.8
63 0.83
64 0.86
65 0.87
66 0.92
67 0.9
68 0.87
69 0.85
70 0.83
71 0.8
72 0.76
73 0.66
74 0.55
75 0.49
76 0.44
77 0.41
78 0.37
79 0.3
80 0.31
81 0.36
82 0.42
83 0.48