Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CKT3

Protein Details
Accession I1CKT3   
Localization Confidence High
Confidence Score 21
NoLS Segment(s)
PositionSequenceProtein Nature
94-114RDTLSKKMKRKKQFGSVQRTVHydrophilic
168-190TSSVKKPKRPMAFKTPRRKPVRAHydrophilic
NLS Segment(s)
PositionSequence
97-105LSKKMKRKK
128-133KPVKKG
152-189WKPREEGGIGWRGKKMTSSVKKPKRPMAFKTPRRKPVR
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MEIAVFTAMNESYEHYAEHLLDQVFQNVKKTHPIDPTPPSVFILDDQPPDLPHTASKPDPVAPEPAPATLQPFTPTKASTRPTLPERKARAFLRDTLSKKMKRKKQFGSVQRTVPSEPSTSHTAHMKKPVKKGPSDRSNTEQRPIERQPSFWKPREEGGIGWRGKKMTSSVKKPKRPMAFKTPRRKPVRAEPVSSVPEKNTAVPLDTIPVTLPHPSSPPVYVMQQPPWMMAPSFNNAGYYLVPSHVMLPQTQLQPQLKTQPQQVYETMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.15
5 0.15
6 0.17
7 0.15
8 0.16
9 0.17
10 0.21
11 0.23
12 0.24
13 0.29
14 0.26
15 0.28
16 0.34
17 0.36
18 0.38
19 0.42
20 0.47
21 0.48
22 0.52
23 0.58
24 0.52
25 0.5
26 0.45
27 0.37
28 0.32
29 0.26
30 0.26
31 0.21
32 0.19
33 0.19
34 0.18
35 0.18
36 0.2
37 0.2
38 0.16
39 0.15
40 0.17
41 0.21
42 0.22
43 0.24
44 0.23
45 0.25
46 0.27
47 0.27
48 0.29
49 0.25
50 0.28
51 0.25
52 0.24
53 0.22
54 0.19
55 0.21
56 0.16
57 0.16
58 0.15
59 0.16
60 0.17
61 0.18
62 0.19
63 0.18
64 0.24
65 0.25
66 0.27
67 0.29
68 0.33
69 0.39
70 0.47
71 0.49
72 0.52
73 0.56
74 0.57
75 0.6
76 0.57
77 0.56
78 0.49
79 0.49
80 0.45
81 0.46
82 0.44
83 0.45
84 0.52
85 0.52
86 0.58
87 0.63
88 0.66
89 0.68
90 0.75
91 0.74
92 0.76
93 0.79
94 0.8
95 0.81
96 0.76
97 0.71
98 0.64
99 0.58
100 0.48
101 0.41
102 0.33
103 0.24
104 0.2
105 0.19
106 0.2
107 0.19
108 0.19
109 0.23
110 0.24
111 0.25
112 0.35
113 0.39
114 0.41
115 0.47
116 0.53
117 0.51
118 0.54
119 0.6
120 0.6
121 0.62
122 0.61
123 0.57
124 0.56
125 0.61
126 0.56
127 0.52
128 0.47
129 0.39
130 0.41
131 0.4
132 0.43
133 0.35
134 0.35
135 0.37
136 0.43
137 0.48
138 0.46
139 0.48
140 0.41
141 0.43
142 0.45
143 0.4
144 0.31
145 0.28
146 0.31
147 0.28
148 0.28
149 0.26
150 0.23
151 0.21
152 0.22
153 0.22
154 0.24
155 0.31
156 0.4
157 0.5
158 0.6
159 0.68
160 0.72
161 0.77
162 0.76
163 0.75
164 0.72
165 0.73
166 0.74
167 0.76
168 0.81
169 0.82
170 0.82
171 0.83
172 0.8
173 0.74
174 0.74
175 0.76
176 0.7
177 0.64
178 0.59
179 0.58
180 0.57
181 0.53
182 0.43
183 0.32
184 0.31
185 0.28
186 0.25
187 0.21
188 0.18
189 0.18
190 0.18
191 0.17
192 0.15
193 0.15
194 0.14
195 0.11
196 0.12
197 0.11
198 0.12
199 0.13
200 0.12
201 0.14
202 0.15
203 0.17
204 0.17
205 0.18
206 0.19
207 0.21
208 0.25
209 0.27
210 0.29
211 0.32
212 0.3
213 0.29
214 0.29
215 0.28
216 0.22
217 0.22
218 0.21
219 0.21
220 0.24
221 0.22
222 0.21
223 0.2
224 0.21
225 0.18
226 0.18
227 0.14
228 0.12
229 0.13
230 0.13
231 0.14
232 0.15
233 0.16
234 0.14
235 0.17
236 0.22
237 0.24
238 0.26
239 0.32
240 0.33
241 0.36
242 0.39
243 0.45
244 0.45
245 0.47
246 0.52
247 0.53
248 0.52
249 0.53