Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BJ00

Protein Details
Accession I1BJ00    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-76IDSNSSKEKRKEQRRKIIRQFVMLKHydrophilic
NLS Segment(s)
PositionSequence
59-68EKRKEQRRKI
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MRTPYQSEHTAYKQYRIKKLADLTGNANWVGIVFQVDGKKITPLFVELSGGIDSNSSKEKRKEQRRKIIRQFVMLKVKKAERVDTPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.55
4 0.53
5 0.5
6 0.54
7 0.53
8 0.51
9 0.45
10 0.41
11 0.39
12 0.38
13 0.3
14 0.25
15 0.17
16 0.14
17 0.11
18 0.07
19 0.05
20 0.04
21 0.07
22 0.07
23 0.08
24 0.09
25 0.09
26 0.11
27 0.1
28 0.1
29 0.08
30 0.09
31 0.1
32 0.09
33 0.1
34 0.08
35 0.09
36 0.09
37 0.09
38 0.07
39 0.06
40 0.06
41 0.07
42 0.12
43 0.12
44 0.17
45 0.22
46 0.32
47 0.42
48 0.54
49 0.64
50 0.7
51 0.79
52 0.85
53 0.92
54 0.93
55 0.93
56 0.85
57 0.83
58 0.78
59 0.75
60 0.76
61 0.67
62 0.61
63 0.57
64 0.57
65 0.55
66 0.53
67 0.5