Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BPW5

Protein Details
Accession I1BPW5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-34GKKLVKHYQQMNQEKKKKEKKTRHPCLYQQVKEHydrophilic
NLS Segment(s)
PositionSequence
16-23KKKKEKKT
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MGKKLVKHYQQMNQEKKKKEKKTRHPCLYQQVKEETTVVLRKRLYKDHLNHKESRQYDFTKVKKNSVLTDYSNKKESSSTGQMNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.83
4 0.86
5 0.86
6 0.87
7 0.87
8 0.88
9 0.91
10 0.94
11 0.93
12 0.9
13 0.87
14 0.86
15 0.86
16 0.78
17 0.71
18 0.64
19 0.55
20 0.48
21 0.41
22 0.3
23 0.23
24 0.24
25 0.2
26 0.19
27 0.2
28 0.24
29 0.26
30 0.3
31 0.32
32 0.36
33 0.42
34 0.49
35 0.58
36 0.59
37 0.6
38 0.59
39 0.62
40 0.55
41 0.53
42 0.47
43 0.4
44 0.43
45 0.47
46 0.5
47 0.52
48 0.53
49 0.53
50 0.53
51 0.52
52 0.5
53 0.45
54 0.44
55 0.39
56 0.47
57 0.48
58 0.47
59 0.49
60 0.44
61 0.41
62 0.38
63 0.37
64 0.36
65 0.38