Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CAA8

Protein Details
Accession I1CAA8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-24SRNVKRKKVVGATKRKTPQDRBasic
NLS Segment(s)
PositionSequence
8-19KRKKVVGATKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MRESRNVKRKKVVGATKRKTPQDRLSVPKGTKDGHYLHFLNDTMDIMDGFPEMRGYFIVMDNAPIHIPKVIDPMIINRGYTPVYLPPYSPELNPIERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.79
4 0.81
5 0.8
6 0.77
7 0.75
8 0.73
9 0.72
10 0.73
11 0.7
12 0.69
13 0.68
14 0.63
15 0.59
16 0.52
17 0.44
18 0.38
19 0.35
20 0.32
21 0.27
22 0.31
23 0.27
24 0.25
25 0.26
26 0.24
27 0.2
28 0.17
29 0.14
30 0.09
31 0.08
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.04
39 0.03
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.12
57 0.12
58 0.13
59 0.13
60 0.16
61 0.2
62 0.21
63 0.2
64 0.16
65 0.17
66 0.17
67 0.17
68 0.15
69 0.15
70 0.19
71 0.2
72 0.2
73 0.22
74 0.27
75 0.29
76 0.27
77 0.27
78 0.27