Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BQ86

Protein Details
Accession I1BQ86    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-78DVVQSFRKEKDRKKEKEKKQKTFNPFALLHydrophilic
NLS Segment(s)
PositionSequence
56-70RKEKDRKKEKEKKQK
Subcellular Location(s) cyto_nucl 10.833, nucl 10, cyto 8.5, mito_nucl 7.999, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MAVQQGESNGTRVSYDRPTLLALAGSPFSKLPPVKMAFIPGVTRTPNQSDVVQSFRKEKDRKKEKEKKQKTFNPFALLGDGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.2
4 0.21
5 0.21
6 0.21
7 0.2
8 0.16
9 0.11
10 0.1
11 0.1
12 0.09
13 0.08
14 0.08
15 0.08
16 0.13
17 0.13
18 0.13
19 0.18
20 0.21
21 0.22
22 0.22
23 0.24
24 0.2
25 0.21
26 0.2
27 0.14
28 0.14
29 0.13
30 0.13
31 0.13
32 0.15
33 0.16
34 0.17
35 0.17
36 0.18
37 0.18
38 0.23
39 0.24
40 0.22
41 0.25
42 0.27
43 0.36
44 0.41
45 0.47
46 0.53
47 0.62
48 0.7
49 0.77
50 0.84
51 0.86
52 0.9
53 0.93
54 0.92
55 0.92
56 0.92
57 0.9
58 0.9
59 0.84
60 0.79
61 0.69
62 0.6
63 0.52