Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CRT0

Protein Details
Accession I1CRT0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
282-302SSRTRSGTRTAARRSTKKRRIHydrophilic
NLS Segment(s)
PositionSequence
284-302RTRSGTRTAARRSTKKRRI
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPYNVDRIVNEIRNYNRTVNVMRSEFEAWKNEIQQQMTELKLMIERNNFINYPLPQAIYQQQPPLFNSPALESGRRDIPRFPTSLGDGQHSNTTCIEAFIRETMDLLDKPEDSNEILDNKRLLAKKYHSQLNSFAQVICIDLSNKLLADVHIDKNKLSWKYIPVAYKNTAYKELEEFALRASIPLGRCVNSWGAQVLLAKSYGNYYNKKLKNKLSNTTSSSMETNTHLAEQTNDTHPDENFDFELLPDLDSPHELEEGNGNEINIATSLSSAVSLLPPSPRSSRTRSGTRTAARRSTKKRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.39
4 0.38
5 0.4
6 0.4
7 0.42
8 0.39
9 0.36
10 0.37
11 0.37
12 0.36
13 0.36
14 0.34
15 0.31
16 0.33
17 0.36
18 0.37
19 0.38
20 0.35
21 0.32
22 0.31
23 0.31
24 0.28
25 0.25
26 0.21
27 0.17
28 0.19
29 0.2
30 0.21
31 0.21
32 0.22
33 0.24
34 0.27
35 0.27
36 0.25
37 0.29
38 0.25
39 0.28
40 0.27
41 0.26
42 0.23
43 0.26
44 0.29
45 0.29
46 0.31
47 0.3
48 0.32
49 0.32
50 0.35
51 0.37
52 0.34
53 0.28
54 0.27
55 0.23
56 0.25
57 0.26
58 0.25
59 0.21
60 0.22
61 0.29
62 0.3
63 0.3
64 0.29
65 0.33
66 0.35
67 0.35
68 0.34
69 0.29
70 0.31
71 0.33
72 0.3
73 0.26
74 0.23
75 0.22
76 0.26
77 0.24
78 0.21
79 0.17
80 0.18
81 0.15
82 0.15
83 0.14
84 0.1
85 0.1
86 0.1
87 0.11
88 0.09
89 0.09
90 0.09
91 0.11
92 0.1
93 0.11
94 0.12
95 0.11
96 0.11
97 0.11
98 0.12
99 0.1
100 0.1
101 0.1
102 0.13
103 0.13
104 0.14
105 0.14
106 0.14
107 0.18
108 0.19
109 0.19
110 0.22
111 0.26
112 0.31
113 0.37
114 0.43
115 0.39
116 0.4
117 0.43
118 0.4
119 0.38
120 0.32
121 0.26
122 0.2
123 0.19
124 0.17
125 0.12
126 0.08
127 0.06
128 0.06
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.05
135 0.09
136 0.12
137 0.14
138 0.17
139 0.17
140 0.17
141 0.19
142 0.24
143 0.21
144 0.2
145 0.19
146 0.19
147 0.23
148 0.27
149 0.29
150 0.27
151 0.3
152 0.31
153 0.33
154 0.32
155 0.3
156 0.3
157 0.27
158 0.25
159 0.22
160 0.21
161 0.18
162 0.16
163 0.14
164 0.1
165 0.11
166 0.09
167 0.08
168 0.07
169 0.09
170 0.09
171 0.13
172 0.14
173 0.14
174 0.14
175 0.16
176 0.18
177 0.16
178 0.17
179 0.12
180 0.11
181 0.12
182 0.13
183 0.11
184 0.09
185 0.08
186 0.08
187 0.07
188 0.09
189 0.14
190 0.18
191 0.2
192 0.25
193 0.35
194 0.41
195 0.49
196 0.54
197 0.57
198 0.63
199 0.67
200 0.71
201 0.67
202 0.67
203 0.64
204 0.61
205 0.53
206 0.45
207 0.39
208 0.31
209 0.26
210 0.21
211 0.18
212 0.15
213 0.14
214 0.13
215 0.13
216 0.13
217 0.14
218 0.16
219 0.18
220 0.2
221 0.21
222 0.22
223 0.22
224 0.25
225 0.24
226 0.23
227 0.19
228 0.17
229 0.16
230 0.14
231 0.18
232 0.13
233 0.13
234 0.11
235 0.11
236 0.11
237 0.12
238 0.13
239 0.1
240 0.1
241 0.1
242 0.1
243 0.14
244 0.15
245 0.18
246 0.17
247 0.16
248 0.15
249 0.15
250 0.15
251 0.1
252 0.09
253 0.06
254 0.05
255 0.06
256 0.06
257 0.06
258 0.05
259 0.06
260 0.07
261 0.08
262 0.09
263 0.13
264 0.15
265 0.19
266 0.24
267 0.29
268 0.34
269 0.41
270 0.48
271 0.52
272 0.61
273 0.62
274 0.65
275 0.69
276 0.72
277 0.73
278 0.72
279 0.74
280 0.73
281 0.78
282 0.81