Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PES2

Protein Details
Accession A0A1D8PES2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-92AEIARIKRARLEKRKRLEEKARELGIBasic
NLS Segment(s)
PositionSequence
71-86RIKRARLEKRKRLEEK
Subcellular Location(s) mito 15.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005886  C:plasma membrane  
GO:0051082  F:unfolded protein binding  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG cal:CAALFM_C109960WA  -  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGFIRAFITRITRTQLETAKFGFYLLSPILVMYYVGLDTDKKFNLPGFWPDPSTLNQIPKEPHEIQAEIARIKRARLEKRKRLEEKARELGISEEDFEEEQQQEILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.36
4 0.36
5 0.35
6 0.31
7 0.29
8 0.26
9 0.2
10 0.14
11 0.14
12 0.11
13 0.1
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.07
26 0.1
27 0.1
28 0.1
29 0.11
30 0.11
31 0.13
32 0.15
33 0.18
34 0.19
35 0.19
36 0.2
37 0.2
38 0.21
39 0.21
40 0.24
41 0.21
42 0.22
43 0.22
44 0.23
45 0.24
46 0.24
47 0.3
48 0.25
49 0.27
50 0.26
51 0.25
52 0.24
53 0.27
54 0.27
55 0.21
56 0.21
57 0.21
58 0.19
59 0.19
60 0.24
61 0.29
62 0.37
63 0.47
64 0.57
65 0.63
66 0.72
67 0.82
68 0.84
69 0.85
70 0.85
71 0.83
72 0.82
73 0.81
74 0.72
75 0.62
76 0.56
77 0.48
78 0.4
79 0.31
80 0.23
81 0.15
82 0.15
83 0.15
84 0.15
85 0.16
86 0.13
87 0.13