Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BLN9

Protein Details
Accession I1BLN9   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-36GKEEHASKKAHHRIKKKHKKNKKSKTTPLHAQAMQBasic
NLS Segment(s)
PositionSequence
8-26SKKAHHRIKKKHKKNKKSK
Subcellular Location(s) nucl 7, mito 6.5, cyto_mito 6.5, cyto 5.5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKEEHASKKAHHRIKKKHKKNKKSKTTPLHAQAMQPTLSAPQDIQLLISPTTVVQAKQLGDGHLGSVGKIGAYGISHHASSGSHVSATLIWIPLFTLLILYCMQIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.82
3 0.89
4 0.9
5 0.91
6 0.93
7 0.95
8 0.96
9 0.96
10 0.96
11 0.95
12 0.95
13 0.94
14 0.91
15 0.89
16 0.85
17 0.8
18 0.7
19 0.61
20 0.54
21 0.46
22 0.37
23 0.28
24 0.21
25 0.15
26 0.14
27 0.12
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.09
35 0.09
36 0.09
37 0.07
38 0.06
39 0.08
40 0.08
41 0.07
42 0.06
43 0.08
44 0.09
45 0.11
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.05
59 0.04
60 0.04
61 0.05
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.1
68 0.12
69 0.14
70 0.11
71 0.1
72 0.1
73 0.11
74 0.11
75 0.12
76 0.12
77 0.1
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.08
84 0.07
85 0.06
86 0.08
87 0.08