Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RGM7

Protein Details
Accession E3RGM7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-70VDKREPQKLKVDKREPQKLKBasic
107-136VDKREPQKLKVDKREPQKLKVDKREPQKLKBasic
NLS Segment(s)
PositionSequence
48-169KLKVDKREPQKLKVDKREPQKLKVDKRDPEPQKLKVDKREPQKLKVDKREPEAEPQKLKVDKREPQKLKVDKREPQKLKVDKREPQKLKVDKREAAPEPQKLKVDKREPVAEPQKLKVDKRE
Subcellular Location(s) nucl 14.5, mito_nucl 11.166, cyto_nucl 10.333, mito 6.5, cyto 4
Family & Domain DBs
KEGG pte:PTT_06965  -  
Amino Acid Sequences MRFSNVISVAFMATSAASLPFSPAGLALAPREGLDSLMRRNAEPEPQKLKVDKREPQKLKVDKREPQKLKVDKRDPEPQKLKVDKREPQKLKVDKREPEAEPQKLKVDKREPQKLKVDKREPQKLKVDKREPQKLKVDKREAAPEPQKLKVDKREPVAEPQKLKVDKREPQKLKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.09
14 0.08
15 0.09
16 0.09
17 0.09
18 0.1
19 0.09
20 0.09
21 0.12
22 0.14
23 0.16
24 0.2
25 0.21
26 0.2
27 0.23
28 0.23
29 0.29
30 0.31
31 0.36
32 0.38
33 0.41
34 0.44
35 0.47
36 0.52
37 0.52
38 0.56
39 0.55
40 0.58
41 0.66
42 0.67
43 0.69
44 0.72
45 0.71
46 0.72
47 0.76
48 0.75
49 0.71
50 0.76
51 0.8
52 0.75
53 0.72
54 0.72
55 0.71
56 0.72
57 0.75
58 0.74
59 0.68
60 0.69
61 0.73
62 0.67
63 0.68
64 0.64
65 0.59
66 0.6
67 0.63
68 0.62
69 0.62
70 0.66
71 0.63
72 0.67
73 0.72
74 0.67
75 0.67
76 0.72
77 0.71
78 0.72
79 0.76
80 0.74
81 0.67
82 0.67
83 0.67
84 0.58
85 0.58
86 0.56
87 0.5
88 0.45
89 0.43
90 0.44
91 0.42
92 0.42
93 0.41
94 0.43
95 0.44
96 0.52
97 0.61
98 0.59
99 0.61
100 0.7
101 0.71
102 0.72
103 0.76
104 0.75
105 0.71
106 0.76
107 0.8
108 0.75
109 0.72
110 0.72
111 0.71
112 0.72
113 0.76
114 0.75
115 0.71
116 0.76
117 0.8
118 0.75
119 0.72
120 0.72
121 0.71
122 0.72
123 0.76
124 0.74
125 0.68
126 0.68
127 0.7
128 0.63
129 0.64
130 0.61
131 0.59
132 0.55
133 0.55
134 0.56
135 0.51
136 0.56
137 0.56
138 0.57
139 0.55
140 0.58
141 0.6
142 0.58
143 0.64
144 0.66
145 0.63
146 0.59
147 0.57
148 0.6
149 0.58
150 0.59
151 0.57
152 0.56
153 0.56
154 0.61
155 0.68
156 0.63