Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CTG7

Protein Details
Accession I1CTG7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MAPCSDKQPKRRYKCPLCPKSFFRLEHKKRHIRIHTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAPCSDKQPKRRYKCPLCPKSFFRLEHKKRHIRIHTGEKPHACHYPGCDKRFSRSDELIRHGRTHDIVQQDRVLLPPLRSIYPISVKPQPVECDIHHQPLLYYQTLSQTGCNHSPPYNRNISLPPIRTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.91
4 0.88
5 0.87
6 0.83
7 0.81
8 0.78
9 0.71
10 0.7
11 0.7
12 0.7
13 0.73
14 0.78
15 0.79
16 0.76
17 0.83
18 0.8
19 0.78
20 0.78
21 0.78
22 0.76
23 0.73
24 0.73
25 0.66
26 0.62
27 0.56
28 0.51
29 0.41
30 0.34
31 0.31
32 0.36
33 0.4
34 0.39
35 0.43
36 0.4
37 0.44
38 0.49
39 0.48
40 0.43
41 0.42
42 0.45
43 0.43
44 0.47
45 0.47
46 0.43
47 0.39
48 0.34
49 0.3
50 0.24
51 0.22
52 0.2
53 0.2
54 0.2
55 0.2
56 0.2
57 0.2
58 0.19
59 0.17
60 0.17
61 0.12
62 0.12
63 0.13
64 0.14
65 0.15
66 0.15
67 0.16
68 0.16
69 0.2
70 0.22
71 0.23
72 0.26
73 0.27
74 0.28
75 0.31
76 0.3
77 0.28
78 0.3
79 0.27
80 0.3
81 0.32
82 0.35
83 0.32
84 0.29
85 0.26
86 0.27
87 0.3
88 0.22
89 0.2
90 0.16
91 0.2
92 0.22
93 0.23
94 0.2
95 0.19
96 0.24
97 0.26
98 0.28
99 0.27
100 0.3
101 0.37
102 0.39
103 0.42
104 0.45
105 0.44
106 0.44
107 0.45
108 0.49
109 0.5
110 0.49