Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CMR2

Protein Details
Accession I1CMR2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-182AALVKEIKKLKQKKKEKEAKEKKEBasic
NLS Segment(s)
PositionSequence
165-182IKKLKQKKKEKEAKEKKE
Subcellular Location(s) cyto 13, cyto_mito 11.166, cyto_nucl 10.166, mito 8, mito_nucl 7.666, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019540  PtdIno-glycan_biosynth_class_S  
Gene Ontology GO:0042765  C:GPI-anchor transamidase complex  
GO:0016255  P:attachment of GPI anchor to protein  
Pfam View protein in Pfam  
PF10510  PIG-S  
Amino Acid Sequences MEYKLTKSDLQPIMKTFLSQLRTLIGSTPHLVTFEPAKKSGITALEKDNWIRSRTFENVANTISTLKSLGQLVDEIPNMVVQDHINSKVRASLNCLAAVRQSLSEEDYLKALRDSIDAIELAEKAFFDPTMVSMLYFPDEHKYAIYMPLFVPTSVPLLAALVKEIKKLKQKKKEKEAKEKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.32
4 0.31
5 0.29
6 0.26
7 0.24
8 0.22
9 0.23
10 0.22
11 0.22
12 0.18
13 0.17
14 0.18
15 0.19
16 0.17
17 0.17
18 0.16
19 0.16
20 0.21
21 0.24
22 0.25
23 0.25
24 0.26
25 0.25
26 0.26
27 0.28
28 0.26
29 0.24
30 0.23
31 0.27
32 0.29
33 0.31
34 0.31
35 0.34
36 0.31
37 0.29
38 0.27
39 0.25
40 0.26
41 0.29
42 0.31
43 0.3
44 0.3
45 0.3
46 0.3
47 0.28
48 0.23
49 0.21
50 0.17
51 0.12
52 0.09
53 0.07
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.09
61 0.09
62 0.08
63 0.07
64 0.08
65 0.07
66 0.07
67 0.06
68 0.04
69 0.06
70 0.07
71 0.1
72 0.12
73 0.12
74 0.13
75 0.17
76 0.18
77 0.17
78 0.22
79 0.24
80 0.22
81 0.24
82 0.24
83 0.19
84 0.18
85 0.18
86 0.13
87 0.09
88 0.08
89 0.07
90 0.08
91 0.09
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.08
100 0.07
101 0.08
102 0.07
103 0.08
104 0.07
105 0.07
106 0.08
107 0.07
108 0.07
109 0.06
110 0.06
111 0.05
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.1
124 0.1
125 0.11
126 0.12
127 0.13
128 0.13
129 0.14
130 0.13
131 0.18
132 0.18
133 0.15
134 0.14
135 0.18
136 0.19
137 0.17
138 0.17
139 0.13
140 0.15
141 0.13
142 0.13
143 0.09
144 0.09
145 0.1
146 0.1
147 0.1
148 0.14
149 0.14
150 0.19
151 0.22
152 0.28
153 0.37
154 0.48
155 0.57
156 0.63
157 0.73
158 0.79
159 0.87
160 0.91
161 0.92
162 0.93