Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BZX6

Protein Details
Accession I1BZX6   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-43ANNSNKSPSHIKNNRKRKDEQPKTPVPRRPSHydrophilic
51-70LSRRHTPSSKPKRSDRMKEIBasic
NLS Segment(s)
PositionSequence
24-46KNNRKRKDEQPKTPVPRRPSVSA
50-64PLSRRHTPSSKPKRS
Subcellular Location(s) nucl 25.5, cyto_nucl 14.333, mito_nucl 13.666
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSNTPQIKRFSQANNSNKSPSHIKNNRKRKDEQPKTPVPRRPSVSAPTTPLSRRHTPSSKPKRSDRMKEITETIKAEMDEKMKKQRASMIISDTKRHELDGVKKRHRSSSAIDQFMYAGPVFNNSPAPSTLPIPSFSPTYVSIEVNQPIHVSSPPPFSLEADLSEIQRKLRSLLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.66
3 0.65
4 0.59
5 0.56
6 0.54
7 0.49
8 0.52
9 0.54
10 0.61
11 0.67
12 0.77
13 0.81
14 0.8
15 0.8
16 0.8
17 0.82
18 0.82
19 0.82
20 0.81
21 0.82
22 0.85
23 0.88
24 0.84
25 0.79
26 0.77
27 0.71
28 0.66
29 0.61
30 0.58
31 0.55
32 0.5
33 0.48
34 0.42
35 0.41
36 0.39
37 0.4
38 0.41
39 0.41
40 0.42
41 0.46
42 0.5
43 0.54
44 0.63
45 0.67
46 0.7
47 0.7
48 0.74
49 0.76
50 0.79
51 0.81
52 0.77
53 0.75
54 0.67
55 0.63
56 0.59
57 0.52
58 0.45
59 0.37
60 0.29
61 0.22
62 0.19
63 0.18
64 0.16
65 0.17
66 0.18
67 0.19
68 0.27
69 0.3
70 0.31
71 0.3
72 0.34
73 0.35
74 0.36
75 0.35
76 0.32
77 0.34
78 0.34
79 0.36
80 0.32
81 0.3
82 0.26
83 0.24
84 0.21
85 0.18
86 0.27
87 0.34
88 0.42
89 0.46
90 0.51
91 0.53
92 0.56
93 0.55
94 0.48
95 0.45
96 0.47
97 0.48
98 0.46
99 0.44
100 0.39
101 0.36
102 0.33
103 0.28
104 0.16
105 0.09
106 0.06
107 0.08
108 0.09
109 0.09
110 0.11
111 0.1
112 0.12
113 0.12
114 0.14
115 0.14
116 0.16
117 0.17
118 0.17
119 0.18
120 0.18
121 0.19
122 0.18
123 0.17
124 0.18
125 0.17
126 0.2
127 0.2
128 0.2
129 0.2
130 0.22
131 0.26
132 0.23
133 0.22
134 0.18
135 0.16
136 0.17
137 0.16
138 0.14
139 0.14
140 0.19
141 0.19
142 0.21
143 0.21
144 0.21
145 0.24
146 0.23
147 0.22
148 0.22
149 0.22
150 0.22
151 0.27
152 0.26
153 0.24
154 0.26
155 0.25
156 0.24