Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BPV3

Protein Details
Accession I1BPV3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39NKLPTQRKKRGPSDNINPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 9.833, mito 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYRRLQMPANEPDPLSFLLNKLPTQRKKRGPSDNINPSPFAAWTVRWLSICQILFELDYLHHGKIPPETTPLGVKLVKWLCNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.17
4 0.15
5 0.18
6 0.2
7 0.21
8 0.27
9 0.35
10 0.41
11 0.5
12 0.58
13 0.63
14 0.69
15 0.77
16 0.79
17 0.78
18 0.79
19 0.8
20 0.81
21 0.77
22 0.69
23 0.6
24 0.5
25 0.42
26 0.33
27 0.25
28 0.15
29 0.09
30 0.11
31 0.13
32 0.14
33 0.14
34 0.14
35 0.13
36 0.18
37 0.18
38 0.15
39 0.13
40 0.13
41 0.12
42 0.12
43 0.11
44 0.06
45 0.1
46 0.11
47 0.11
48 0.12
49 0.13
50 0.14
51 0.18
52 0.2
53 0.18
54 0.2
55 0.21
56 0.22
57 0.24
58 0.24
59 0.24
60 0.23
61 0.21
62 0.27
63 0.31