Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C3E2

Protein Details
Accession I1C3E2   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-40DLPIEIKPKPIKRKTKAPPIRYDIHydrophilic
NLS Segment(s)
PositionSequence
23-33KPKPIKRKTKA
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MPKQPIQATGSMEVDSDLPIEIKPKPIKRKTKAPPIRYDIVSDVMNQKADISVGDLMVAAPTLRRKLASACRPKRIPVTETSKETMAVIEEDDIHTTAVYSKINIGDKTVKVLVDCGAAKTCMSKSLADALGLEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.11
4 0.08
5 0.07
6 0.07
7 0.09
8 0.1
9 0.18
10 0.25
11 0.34
12 0.44
13 0.53
14 0.64
15 0.69
16 0.79
17 0.8
18 0.84
19 0.85
20 0.83
21 0.82
22 0.78
23 0.77
24 0.67
25 0.6
26 0.5
27 0.43
28 0.35
29 0.27
30 0.23
31 0.19
32 0.18
33 0.15
34 0.13
35 0.1
36 0.1
37 0.08
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.03
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.13
54 0.22
55 0.3
56 0.4
57 0.45
58 0.52
59 0.53
60 0.55
61 0.56
62 0.52
63 0.45
64 0.41
65 0.45
66 0.42
67 0.44
68 0.43
69 0.37
70 0.33
71 0.31
72 0.24
73 0.15
74 0.11
75 0.08
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.07
82 0.06
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.09
89 0.14
90 0.18
91 0.18
92 0.2
93 0.24
94 0.24
95 0.29
96 0.28
97 0.25
98 0.21
99 0.22
100 0.19
101 0.18
102 0.18
103 0.16
104 0.16
105 0.16
106 0.16
107 0.18
108 0.18
109 0.17
110 0.19
111 0.18
112 0.18
113 0.25
114 0.26
115 0.23
116 0.23