Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BHR9

Protein Details
Accession I1BHR9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-30HQSLISQDKKKRSKINRCSYVITTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, cyto 4, E.R. 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000101  GGT_peptidase  
IPR029055  Ntn_hydrolases_N  
Gene Ontology GO:0016020  C:membrane  
GO:0036374  F:glutathione hydrolase activity  
GO:0006751  P:glutathione catabolic process  
Pfam View protein in Pfam  
PF01019  G_glu_transpept  
Amino Acid Sequences MSELGEHQSLISQDKKKRSKINRCSYVITTAVILSVGSLLLTILVYKGSTSLDSPVDFRGRTAVGSKGAVAVETKECSDIGVQILKEGGNSVDAAIASTLCIGVMNNFATGNTKCLGGFMLIRSPNGTFEFIDFRETAPAAATKDMFVQDPVLAQIGGLSVGIPGEIRGLELAHKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.59
4 0.68
5 0.76
6 0.79
7 0.83
8 0.87
9 0.87
10 0.83
11 0.81
12 0.73
13 0.67
14 0.56
15 0.46
16 0.35
17 0.25
18 0.2
19 0.14
20 0.11
21 0.06
22 0.05
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.09
39 0.1
40 0.11
41 0.12
42 0.15
43 0.17
44 0.16
45 0.15
46 0.15
47 0.14
48 0.14
49 0.15
50 0.14
51 0.13
52 0.14
53 0.14
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.09
69 0.09
70 0.08
71 0.09
72 0.08
73 0.08
74 0.07
75 0.06
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.02
88 0.03
89 0.03
90 0.03
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.1
97 0.1
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.11
104 0.08
105 0.09
106 0.09
107 0.14
108 0.15
109 0.15
110 0.16
111 0.16
112 0.17
113 0.18
114 0.18
115 0.12
116 0.14
117 0.17
118 0.17
119 0.19
120 0.17
121 0.16
122 0.17
123 0.16
124 0.15
125 0.12
126 0.14
127 0.12
128 0.14
129 0.14
130 0.12
131 0.14
132 0.15
133 0.14
134 0.12
135 0.13
136 0.11
137 0.11
138 0.12
139 0.11
140 0.09
141 0.08
142 0.08
143 0.07
144 0.06
145 0.06
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.07