Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CM70

Protein Details
Accession I1CM70   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-102AKQYHRILKRRAARTRWKNKVNETGKKTHydrophilic
NLS Segment(s)
PositionSequence
83-94KRRAARTRWKNK
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001289  NFYA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences MLHPHEAYAYQAAQNIDLHQPDTRHSDLYHPPPHSPPTPYTMPTTTTSYHRPIMNHSQHHQPIEPTGEEPLYVNAKQYHRILKRRAARTRWKNKVNETGKKTLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.18
5 0.18
6 0.17
7 0.17
8 0.19
9 0.24
10 0.23
11 0.22
12 0.21
13 0.26
14 0.31
15 0.39
16 0.43
17 0.39
18 0.4
19 0.41
20 0.45
21 0.42
22 0.38
23 0.31
24 0.3
25 0.31
26 0.3
27 0.31
28 0.28
29 0.28
30 0.27
31 0.28
32 0.24
33 0.24
34 0.26
35 0.25
36 0.27
37 0.26
38 0.24
39 0.26
40 0.34
41 0.38
42 0.38
43 0.37
44 0.42
45 0.42
46 0.44
47 0.39
48 0.3
49 0.25
50 0.25
51 0.23
52 0.15
53 0.14
54 0.13
55 0.12
56 0.12
57 0.12
58 0.13
59 0.12
60 0.14
61 0.18
62 0.2
63 0.24
64 0.27
65 0.35
66 0.4
67 0.48
68 0.52
69 0.56
70 0.64
71 0.7
72 0.76
73 0.75
74 0.78
75 0.81
76 0.86
77 0.87
78 0.87
79 0.84
80 0.83
81 0.85
82 0.84
83 0.83
84 0.79
85 0.77