Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RRW6

Protein Details
Accession E3RRW6   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-97YPSISEQRRPSRKPQDDNNIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
KEGG pte:PTT_11607  -  
Amino Acid Sequences GLSREHGKNDLFEPNVRVPGRYPSFTDGFQPLDISNNSDDRAFDSELPTTITTRQDKKSVAFNDYNRTLKNRRDVYYPSISEQRRPSRKPQDDNNIDIYSHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.36
4 0.34
5 0.29
6 0.36
7 0.38
8 0.35
9 0.34
10 0.31
11 0.34
12 0.33
13 0.34
14 0.27
15 0.24
16 0.22
17 0.2
18 0.16
19 0.17
20 0.16
21 0.15
22 0.14
23 0.14
24 0.14
25 0.13
26 0.13
27 0.12
28 0.15
29 0.14
30 0.13
31 0.13
32 0.13
33 0.13
34 0.15
35 0.13
36 0.1
37 0.11
38 0.15
39 0.18
40 0.21
41 0.23
42 0.25
43 0.26
44 0.27
45 0.34
46 0.32
47 0.34
48 0.35
49 0.35
50 0.38
51 0.42
52 0.42
53 0.35
54 0.38
55 0.37
56 0.37
57 0.45
58 0.44
59 0.42
60 0.45
61 0.48
62 0.49
63 0.53
64 0.5
65 0.44
66 0.46
67 0.45
68 0.46
69 0.51
70 0.54
71 0.55
72 0.58
73 0.65
74 0.68
75 0.77
76 0.79
77 0.8
78 0.81
79 0.78
80 0.78
81 0.74
82 0.64