Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BMK9

Protein Details
Accession I1BMK9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-126ETSVAKPKIKQKVKREKLTPKSEVEHydrophilic
NLS Segment(s)
PositionSequence
105-120VAKPKIKQKVKREKLT
Subcellular Location(s) nucl 19.5, mito_nucl 13.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MRDYVDRFEKLVALFNRQRKLKSGWKSIDNEVLKDTFIGGIKPVSMKMLVKQHLPATLSEAQTIAITESDEVEESSDVGPSDLDSESDGEQVILSRRKTKFETSVAKPKIKQKVKREKLTPKSEVEKKMDDLTESLQKLTLLVESKNGASQSPRKVIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.5
4 0.51
5 0.52
6 0.49
7 0.54
8 0.55
9 0.57
10 0.61
11 0.59
12 0.63
13 0.66
14 0.64
15 0.66
16 0.58
17 0.49
18 0.41
19 0.35
20 0.28
21 0.23
22 0.2
23 0.12
24 0.11
25 0.1
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.09
32 0.1
33 0.1
34 0.14
35 0.21
36 0.22
37 0.23
38 0.25
39 0.26
40 0.27
41 0.27
42 0.23
43 0.21
44 0.24
45 0.23
46 0.21
47 0.19
48 0.16
49 0.15
50 0.15
51 0.1
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.07
75 0.07
76 0.05
77 0.05
78 0.06
79 0.09
80 0.12
81 0.13
82 0.2
83 0.22
84 0.26
85 0.29
86 0.33
87 0.36
88 0.4
89 0.47
90 0.47
91 0.56
92 0.58
93 0.59
94 0.58
95 0.6
96 0.62
97 0.63
98 0.66
99 0.66
100 0.73
101 0.78
102 0.84
103 0.85
104 0.86
105 0.87
106 0.87
107 0.81
108 0.76
109 0.75
110 0.73
111 0.7
112 0.64
113 0.58
114 0.51
115 0.51
116 0.46
117 0.38
118 0.32
119 0.29
120 0.31
121 0.28
122 0.26
123 0.22
124 0.21
125 0.2
126 0.19
127 0.18
128 0.13
129 0.13
130 0.16
131 0.17
132 0.18
133 0.2
134 0.2
135 0.18
136 0.22
137 0.29
138 0.34