Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CWC6

Protein Details
Accession I1CWC6    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-33KWTINRIRKEEKNIKARNRGGRPBasic
94-115FISYTNQKKRLKWCRDKASWTVHydrophilic
NLS Segment(s)
PositionSequence
18-33RKEEKNIKARNRGGRP
76-90RRLLRKIGFKSGIKK
Subcellular Location(s) mito_nucl 13.666, mito 13.5, nucl 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MDISRTTGVSKWTINRIRKEEKNIKARNRGGRPVVVKKITNAIIRLKFRQGLLRTASDAQLFLRSLGYSISKRSVRRLLRKIGFKSGIKKYKPFISYTNQKKRLKWCRDKASWTVEDWKSVIFSDETKINVWGAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.61
4 0.67
5 0.7
6 0.76
7 0.76
8 0.76
9 0.79
10 0.8
11 0.8
12 0.81
13 0.81
14 0.81
15 0.78
16 0.76
17 0.69
18 0.67
19 0.65
20 0.63
21 0.63
22 0.57
23 0.51
24 0.45
25 0.47
26 0.45
27 0.41
28 0.35
29 0.35
30 0.37
31 0.39
32 0.41
33 0.38
34 0.35
35 0.33
36 0.38
37 0.32
38 0.31
39 0.3
40 0.29
41 0.28
42 0.27
43 0.27
44 0.2
45 0.18
46 0.13
47 0.12
48 0.11
49 0.09
50 0.08
51 0.07
52 0.07
53 0.08
54 0.1
55 0.08
56 0.1
57 0.15
58 0.18
59 0.19
60 0.24
61 0.32
62 0.37
63 0.46
64 0.51
65 0.56
66 0.59
67 0.66
68 0.64
69 0.63
70 0.61
71 0.54
72 0.55
73 0.55
74 0.57
75 0.52
76 0.53
77 0.49
78 0.51
79 0.5
80 0.46
81 0.41
82 0.41
83 0.48
84 0.56
85 0.63
86 0.66
87 0.68
88 0.7
89 0.76
90 0.79
91 0.8
92 0.8
93 0.79
94 0.8
95 0.83
96 0.84
97 0.8
98 0.78
99 0.69
100 0.61
101 0.6
102 0.5
103 0.45
104 0.39
105 0.33
106 0.25
107 0.23
108 0.22
109 0.14
110 0.14
111 0.15
112 0.18
113 0.18
114 0.19
115 0.2