Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BLM5

Protein Details
Accession I1BLM5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-41LDCKPSEKTKSKPHNEKRSLHEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, nucl 10, cyto 9.5, cyto_pero 5.666, mito 5
Family & Domain DBs
Amino Acid Sequences MDIGTETYPVDYITNYDEHLDCKPSEKTKSKPHNEKRSLHEKLNKMKIKFIHTGNMVMLLKNNYSSWFTKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.12
5 0.14
6 0.15
7 0.17
8 0.15
9 0.18
10 0.22
11 0.25
12 0.32
13 0.37
14 0.43
15 0.51
16 0.61
17 0.67
18 0.74
19 0.79
20 0.82
21 0.83
22 0.81
23 0.77
24 0.77
25 0.71
26 0.66
27 0.63
28 0.59
29 0.6
30 0.65
31 0.64
32 0.55
33 0.56
34 0.54
35 0.53
36 0.51
37 0.44
38 0.41
39 0.37
40 0.37
41 0.33
42 0.35
43 0.29
44 0.24
45 0.24
46 0.2
47 0.19
48 0.19
49 0.19
50 0.15
51 0.19
52 0.22