Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CN67

Protein Details
Accession I1CN67   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-99APFSTSERKKRSKNDKRSLEVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001247  ExoRNase_PH_dom1  
IPR027408  PNPase/RNase_PH_dom_sf  
IPR020568  Ribosomal_S5_D2-typ_fold  
Gene Ontology GO:0000176  C:nuclear exosome (RNase complex)  
Pfam View protein in Pfam  
PF01138  RNase_PH  
Amino Acid Sequences MSRLELLTPEGLRVDGRRANELRKITAKTSVFSQADGSAYIEQGNTKCLAAVYGPREVRHRMQALSDRAIINVEFNIAPFSTSERKKRSKNDKRSLEVAAFIRQTFEPVVLTTQFPRSQIDIYLQVFQNDGGITI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.21
4 0.28
5 0.31
6 0.35
7 0.41
8 0.42
9 0.42
10 0.44
11 0.46
12 0.4
13 0.46
14 0.42
15 0.36
16 0.36
17 0.39
18 0.33
19 0.3
20 0.29
21 0.22
22 0.21
23 0.21
24 0.19
25 0.11
26 0.11
27 0.1
28 0.09
29 0.1
30 0.09
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.12
39 0.12
40 0.18
41 0.19
42 0.2
43 0.23
44 0.25
45 0.27
46 0.28
47 0.28
48 0.22
49 0.25
50 0.31
51 0.31
52 0.3
53 0.3
54 0.24
55 0.22
56 0.22
57 0.18
58 0.12
59 0.08
60 0.07
61 0.05
62 0.05
63 0.06
64 0.05
65 0.06
66 0.06
67 0.1
68 0.15
69 0.2
70 0.27
71 0.34
72 0.42
73 0.49
74 0.59
75 0.67
76 0.71
77 0.78
78 0.82
79 0.83
80 0.81
81 0.78
82 0.71
83 0.61
84 0.54
85 0.45
86 0.38
87 0.3
88 0.24
89 0.23
90 0.19
91 0.2
92 0.16
93 0.14
94 0.11
95 0.11
96 0.13
97 0.12
98 0.14
99 0.14
100 0.2
101 0.21
102 0.21
103 0.23
104 0.23
105 0.23
106 0.23
107 0.25
108 0.26
109 0.27
110 0.31
111 0.29
112 0.27
113 0.26
114 0.24
115 0.22