Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CB37

Protein Details
Accession I1CB37    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-60SKTFRFCRSKCHKNFKMKRNPRKVRWTKAFRKASGHydrophilic
NLS Segment(s)
PositionSequence
41-58KMKRNPRKVRWTKAFRKA
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MHITRCYFCSGPCYPGHGTMFVRNDSKTFRFCRSKCHKNFKMKRNPRKVRWTKAFRKASGKEMVIDSTFEFEKRRNVPVRYDRNLMATTIKAMKRVQEIRAKRERAFYKNRMADNKDKEKADDIRVVNQNIELAPLEHKKRLQAIKTEKEQTGSMDMEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.33
5 0.33
6 0.35
7 0.37
8 0.35
9 0.35
10 0.3
11 0.3
12 0.32
13 0.34
14 0.33
15 0.34
16 0.39
17 0.47
18 0.47
19 0.56
20 0.6
21 0.67
22 0.71
23 0.78
24 0.78
25 0.79
26 0.89
27 0.88
28 0.9
29 0.9
30 0.91
31 0.91
32 0.92
33 0.9
34 0.91
35 0.9
36 0.89
37 0.89
38 0.88
39 0.87
40 0.87
41 0.86
42 0.79
43 0.78
44 0.7
45 0.66
46 0.62
47 0.52
48 0.43
49 0.36
50 0.33
51 0.24
52 0.22
53 0.16
54 0.12
55 0.11
56 0.1
57 0.1
58 0.1
59 0.16
60 0.17
61 0.24
62 0.28
63 0.29
64 0.37
65 0.46
66 0.53
67 0.51
68 0.51
69 0.45
70 0.42
71 0.41
72 0.33
73 0.25
74 0.16
75 0.14
76 0.17
77 0.17
78 0.17
79 0.17
80 0.19
81 0.25
82 0.28
83 0.32
84 0.36
85 0.4
86 0.45
87 0.54
88 0.55
89 0.5
90 0.55
91 0.56
92 0.55
93 0.6
94 0.57
95 0.58
96 0.61
97 0.64
98 0.62
99 0.62
100 0.63
101 0.63
102 0.66
103 0.61
104 0.56
105 0.52
106 0.52
107 0.5
108 0.46
109 0.44
110 0.37
111 0.4
112 0.44
113 0.43
114 0.38
115 0.34
116 0.3
117 0.22
118 0.22
119 0.14
120 0.1
121 0.14
122 0.2
123 0.24
124 0.27
125 0.28
126 0.31
127 0.39
128 0.46
129 0.47
130 0.5
131 0.57
132 0.63
133 0.7
134 0.72
135 0.65
136 0.6
137 0.55
138 0.48
139 0.43