Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CLM7

Protein Details
Accession I1CLM7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSLHWKIDQRKPKNNTTNNNTLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPSLHWKIDQRKPKNNTTNNNTLNIENNELAVIGSVYYDTVPGSSSIIPLKRALFEEHSLADWSWKNPDKSKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.82
4 0.79
5 0.8
6 0.72
7 0.71
8 0.62
9 0.52
10 0.48
11 0.4
12 0.35
13 0.24
14 0.21
15 0.17
16 0.15
17 0.14
18 0.08
19 0.06
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.06
31 0.06
32 0.07
33 0.1
34 0.11
35 0.13
36 0.14
37 0.15
38 0.15
39 0.17
40 0.19
41 0.2
42 0.21
43 0.22
44 0.22
45 0.22
46 0.22
47 0.2
48 0.21
49 0.19
50 0.19
51 0.25
52 0.3
53 0.34
54 0.41
55 0.52