Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CIM4

Protein Details
Accession I1CIM4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-108DPTWSRPRMPVRKGQRLRNEGCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 10
Family & Domain DBs
Amino Acid Sequences MSIPQPNHHYPVQEEYQKTVLVENPPNPIYPPPPAGCLQPGMGPNLVFHFPPYATPQPPVMSPPGPSVIEKTVDIKGPQETYLVQGDPTWSRPRMPVRKGQRLRNEGCVIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.39
4 0.36
5 0.33
6 0.29
7 0.25
8 0.25
9 0.29
10 0.27
11 0.3
12 0.3
13 0.31
14 0.3
15 0.29
16 0.25
17 0.23
18 0.26
19 0.22
20 0.24
21 0.25
22 0.25
23 0.23
24 0.22
25 0.19
26 0.17
27 0.17
28 0.16
29 0.15
30 0.14
31 0.13
32 0.13
33 0.13
34 0.1
35 0.1
36 0.09
37 0.08
38 0.09
39 0.15
40 0.17
41 0.17
42 0.18
43 0.19
44 0.18
45 0.19
46 0.19
47 0.17
48 0.14
49 0.14
50 0.15
51 0.16
52 0.16
53 0.16
54 0.17
55 0.16
56 0.17
57 0.16
58 0.17
59 0.15
60 0.17
61 0.17
62 0.16
63 0.17
64 0.16
65 0.16
66 0.15
67 0.13
68 0.14
69 0.16
70 0.15
71 0.13
72 0.12
73 0.14
74 0.15
75 0.19
76 0.22
77 0.2
78 0.22
79 0.28
80 0.39
81 0.46
82 0.5
83 0.56
84 0.61
85 0.71
86 0.77
87 0.81
88 0.81
89 0.8
90 0.79
91 0.79