Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C6Q9

Protein Details
Accession I1C6Q9    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-56GKSMIRRISRKTKMQSKNSAGRHRLHydrophilic
NLS Segment(s)
PositionSequence
41-44RKTK
89-89R
91-112VNPKTITRTFKRKGLKSAKKKT
Subcellular Location(s) nucl 11.5, mito_nucl 9, cyto 6, mito 5.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTAKNADKHAQIENMMNHSISWDVIQKKVGCGKSMIRRISRKTKMQSKNSAGRHRLLTPREETKAARDIRIGLSKSAADASFGVKKPDRSVNPKTITRTFKRKGLKSAKKKTALPLNNDRQKARYDWAKAHKDWSETDWERVVFSDEIKIQKRGSNGLEYAWKEDNAPYRDHHYKKKHAYGGGGIMLWSCITIHGGATCPGYKVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.25
5 0.22
6 0.2
7 0.14
8 0.13
9 0.15
10 0.16
11 0.18
12 0.24
13 0.24
14 0.28
15 0.35
16 0.36
17 0.31
18 0.32
19 0.38
20 0.43
21 0.5
22 0.52
23 0.53
24 0.58
25 0.65
26 0.72
27 0.73
28 0.72
29 0.73
30 0.77
31 0.79
32 0.81
33 0.83
34 0.8
35 0.81
36 0.81
37 0.81
38 0.73
39 0.67
40 0.62
41 0.57
42 0.56
43 0.49
44 0.45
45 0.42
46 0.44
47 0.43
48 0.42
49 0.37
50 0.34
51 0.39
52 0.36
53 0.31
54 0.26
55 0.26
56 0.27
57 0.32
58 0.29
59 0.21
60 0.21
61 0.2
62 0.19
63 0.19
64 0.14
65 0.09
66 0.09
67 0.11
68 0.15
69 0.16
70 0.19
71 0.19
72 0.2
73 0.23
74 0.3
75 0.32
76 0.34
77 0.4
78 0.46
79 0.49
80 0.52
81 0.53
82 0.53
83 0.55
84 0.52
85 0.56
86 0.49
87 0.51
88 0.55
89 0.54
90 0.57
91 0.61
92 0.67
93 0.68
94 0.75
95 0.77
96 0.74
97 0.73
98 0.69
99 0.68
100 0.62
101 0.58
102 0.58
103 0.59
104 0.61
105 0.61
106 0.56
107 0.48
108 0.45
109 0.4
110 0.35
111 0.32
112 0.29
113 0.34
114 0.43
115 0.48
116 0.46
117 0.49
118 0.47
119 0.42
120 0.4
121 0.35
122 0.35
123 0.3
124 0.32
125 0.29
126 0.26
127 0.24
128 0.23
129 0.24
130 0.15
131 0.14
132 0.15
133 0.16
134 0.22
135 0.24
136 0.26
137 0.24
138 0.26
139 0.28
140 0.29
141 0.29
142 0.28
143 0.26
144 0.26
145 0.31
146 0.29
147 0.32
148 0.29
149 0.26
150 0.22
151 0.25
152 0.32
153 0.28
154 0.29
155 0.27
156 0.33
157 0.42
158 0.47
159 0.53
160 0.54
161 0.62
162 0.7
163 0.77
164 0.76
165 0.7
166 0.68
167 0.63
168 0.58
169 0.5
170 0.4
171 0.3
172 0.24
173 0.2
174 0.16
175 0.11
176 0.06
177 0.05
178 0.06
179 0.07
180 0.07
181 0.08
182 0.1
183 0.12
184 0.15
185 0.16