Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C4N2

Protein Details
Accession I1C4N2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ATLNQVIRKCRKSKPKMSKTPALEGCHydrophilic
34-56CNKVYTTKPKKPNSAQRKVARVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MATLNQVIRKCRKSKPKMSKTPALEGCYQRKGVCNKVYTTKPKKPNSAQRKVARVKLTNGKVVAAYIPGEGHNLQEHSVVLVRGGRVPDLPGVRYHLVRGALDLQGVATRTTSRSKYGTKKPSKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.85
4 0.88
5 0.9
6 0.89
7 0.84
8 0.83
9 0.78
10 0.7
11 0.66
12 0.61
13 0.59
14 0.54
15 0.5
16 0.41
17 0.41
18 0.42
19 0.44
20 0.44
21 0.41
22 0.4
23 0.46
24 0.52
25 0.56
26 0.61
27 0.62
28 0.65
29 0.68
30 0.74
31 0.76
32 0.8
33 0.8
34 0.8
35 0.81
36 0.77
37 0.8
38 0.76
39 0.73
40 0.68
41 0.6
42 0.55
43 0.54
44 0.51
45 0.44
46 0.4
47 0.34
48 0.27
49 0.25
50 0.19
51 0.11
52 0.09
53 0.06
54 0.06
55 0.05
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.07
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.09
74 0.1
75 0.14
76 0.14
77 0.15
78 0.14
79 0.19
80 0.21
81 0.21
82 0.2
83 0.2
84 0.2
85 0.19
86 0.2
87 0.18
88 0.16
89 0.16
90 0.15
91 0.11
92 0.11
93 0.12
94 0.1
95 0.08
96 0.09
97 0.12
98 0.18
99 0.2
100 0.23
101 0.28
102 0.36
103 0.45
104 0.54
105 0.63
106 0.68