Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CNI5

Protein Details
Accession I1CNI5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
96-129FGFGPHKNKKPYVRSKGRKFERARGKRASRGFKVBasic
NLS Segment(s)
PositionSequence
96-129FGFGPHKNKKPYVRSKGRKFERARGKRASRGFKV
Subcellular Location(s) mito 20, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRVNRPPVTVSRIVRNTKENKTTVVVGTVTDDSRLLDLPKLSVAALHFTKTAKARILKAGGECLTLDQLALRAPTGSNTILIRGAKNARESVKHFGFGPHKNKKPYVRSKGRKFERARGKRASRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.59
4 0.59
5 0.6
6 0.64
7 0.56
8 0.51
9 0.49
10 0.48
11 0.4
12 0.35
13 0.27
14 0.2
15 0.2
16 0.19
17 0.15
18 0.13
19 0.12
20 0.1
21 0.1
22 0.11
23 0.09
24 0.09
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.12
33 0.12
34 0.12
35 0.13
36 0.12
37 0.16
38 0.17
39 0.19
40 0.19
41 0.21
42 0.22
43 0.26
44 0.28
45 0.26
46 0.25
47 0.26
48 0.21
49 0.19
50 0.17
51 0.12
52 0.11
53 0.09
54 0.08
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.06
63 0.08
64 0.08
65 0.09
66 0.09
67 0.1
68 0.12
69 0.13
70 0.12
71 0.14
72 0.17
73 0.18
74 0.2
75 0.23
76 0.23
77 0.26
78 0.3
79 0.34
80 0.33
81 0.32
82 0.3
83 0.33
84 0.38
85 0.42
86 0.48
87 0.5
88 0.56
89 0.6
90 0.67
91 0.7
92 0.73
93 0.76
94 0.77
95 0.78
96 0.82
97 0.87
98 0.91
99 0.91
100 0.9
101 0.86
102 0.85
103 0.85
104 0.84
105 0.81
106 0.81
107 0.8
108 0.79
109 0.82