Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BP27

Protein Details
Accession I1BP27    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKSKLKKLKKRQRLNNEKSSSDHydrophilic
NLS Segment(s)
PositionSequence
4-12KLKKLKKRQ
Subcellular Location(s) mito_nucl 12.332, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MKSKLKKLKKRQRLNNEKSSSDISTVSNSTSCGQSRHVNANKYEYFTPCTVDPGRDFPNPLPLSLEIPRRFTVLSSISVQEVILFLRKYITVVTNKML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.87
4 0.77
5 0.7
6 0.63
7 0.53
8 0.43
9 0.35
10 0.25
11 0.22
12 0.21
13 0.19
14 0.15
15 0.15
16 0.14
17 0.15
18 0.15
19 0.14
20 0.17
21 0.2
22 0.23
23 0.32
24 0.36
25 0.37
26 0.38
27 0.43
28 0.41
29 0.39
30 0.37
31 0.29
32 0.27
33 0.23
34 0.24
35 0.17
36 0.19
37 0.17
38 0.17
39 0.17
40 0.18
41 0.21
42 0.21
43 0.22
44 0.19
45 0.28
46 0.27
47 0.26
48 0.24
49 0.21
50 0.24
51 0.25
52 0.34
53 0.26
54 0.29
55 0.29
56 0.28
57 0.27
58 0.24
59 0.25
60 0.19
61 0.2
62 0.19
63 0.2
64 0.19
65 0.19
66 0.18
67 0.14
68 0.12
69 0.1
70 0.12
71 0.11
72 0.1
73 0.12
74 0.12
75 0.13
76 0.15
77 0.2
78 0.21